Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF (Active) Recombinant Protein

Source : Escherichia Coli. MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Product Specifications

Product Name Alternative

Phenylpyruvate tautomerase||Glycosylation-inhibiting factor||GIF||MMIF||MIF.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Storage Conditions

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml. Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Amino Acids

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H4D (H4C4) (NM_003539) Human Tagged ORF Clone Lentiviral Particle
RC215149L4V 200 µL

HIST1H4D (H4C4) (NM_003539) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RN5S188 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV743914 1.0 µg DNA

RN5S188 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PCP4 (Purkinje Cell Protein 4, Brain-specific Antigen PCP-4, Brain-specific Polypeptide PEP-19, PEP19) (PE)
131004-PE 100 µL

PCP4 (Purkinje Cell Protein 4, Brain-specific Antigen PCP-4, Brain-specific Polypeptide PEP-19, PEP19) (PE)

Sign In for Pricing
View Details
CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 490)
124729-ML490 100 µL

CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Polyclonal Asporin Antibody
H00054829-B01P 0.05 mg

Mouse Polyclonal Asporin Antibody

Sign In for Pricing
View Details
Eukaryotic Human Prion Protein (PRNP)
RPU59696-01 50 µg

Eukaryotic Human Prion Protein (PRNP)

Sign In for Pricing
View Details