IL37 Recombinant Protein

Source : Escherichia Coli. Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.The IL37 is purified by proprietary chromatographic techniques. Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 cytokine family. There are 5 alternatively spliced transcript variants encoding distinct isoforms with distinct expression profiles. The longest IL-1F7 transcript, named IL1F7b or IL1F7 isoform 1, encodes a 218 aa residues proprotein and containing a 45 aa propeptide which is cleaved to produce a mature protein. IL1F7b binds to IL18 Rb with low affinity however it doesn't exert any IL18 agonistic or antagonistic effects. IL1F7b also binds IL18BP (interleukin 18 binding protein), which is an inhibitory binding protein of interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.

Product Specifications

Product Name Alternative

Interleukin-37||FIL1 zeta||IL-1X||Interleukin-1 family member 7||IL-1F7||Interleukin-1 homolog 4||IL-1H||IL-1H4||Interleukin-1 zeta||IL-1 zeta||Interleukin-1-related protein||IL-1RP1||Interleukin-23||IL-37||IL37||FIL1Z||IL1F7||IL1H4||IL1RP1||FIL1||FI

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.

Storage Conditions

Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions. As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 μg/ml (100 μl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1μg/ml.

Amino Acids

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD.