Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIL 17 A/F Recombinant Protein

Source : Escherichia Coli. Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa. The IL-17 A/F is purified by proprietary chromatographic techniques. Human IL-17A/F is a 40kDa glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins of the IL-17 family, IL-17A and IL17F. Proteins of the 6 homodimeric IL17 family show a cysteine knot motif that contains two disulfide-bonds. Human IL17A is produced as a 155 a.a precursor that includes a 23 amino acids signal sequence and a 132 amino acid chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153 amino acid precursor with a 20 amino acid signal sequence and a 133 amino acid region. Similar to IL17A, IL17F also has an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50% amino acid sequence identity. Human IL17A & IL17F show approximately 60% homology in their amino acid sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. IL17RA and IL17RC form a heterodimer for the binding of IL17A and IL17F. IL-17A/F binds IL-17RA. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent) .

Product Specifications

Product Name Alternative

IL17A/F||IL17 A/F||IL-17A/F||IL-17 A/F||IL17AF||IL-17 AF||Interleukin-17 A/F||Interleukin-17 AF.

Purification

Greater than 97.0% as determined by SDS-PAGE.

Components

Lyophilized from a concentrated (1mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Mouse IL17 A/F in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Solute carrier family 22 member 18 Protein - (Dry Ice)
H00005002-P01-2ug 2 µg

Recombinant Human Solute carrier family 22 member 18 Protein - (Dry Ice)

Ask
View Details
Mouse RAVER1 siRNA
abx930983-01 15 nmol

Mouse RAVER1 siRNA

Ask
View Details
Mouse RAVER1 siRNA
abx930983-02 30 nmol

Mouse RAVER1 siRNA

Ask
View Details
Kmt5b Mouse shRNA Lentiviral Particle (Locus ID 225888)
TL512532V 500 µL Each

Kmt5b Mouse shRNA Lentiviral Particle (Locus ID 225888)

Ask
View Details
Anti-KCNG2 Antibody
CTA4288-01 30 µL

Anti-KCNG2 Antibody

Ask
View Details
Anti-KCNG2 Antibody
CTA4288-02 50 μL

Anti-KCNG2 Antibody

Ask
View Details