Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIL 17F Recombinant Protein

Source : Escherichia Coli. IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques. IL-17F having an accession number of Q96PD4 is a cytokine that shares sequence similarity with IL17. IL-17F is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM-CSF. IL-17F inhibits the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. IL-17F induces stromal cells to produce proinflammatory and hematopoietic cytokines. Intestinal IL17F gene expression is increased in active CD.IL-17A & IL-17F alleles influence the susceptibility to and pathophysiological features of ulcerative colitis independently. IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia. The initiation of IL-17F/IL-17R signaling pathway requires the receptor ubiquitination by TRAF6. IL-17F induces expression of IFN-gamma-inducible protein 10 (IP-10) by activating Raf1-mitogen-activated protein kinase 1/2-extracellular-regulated kinase 1/2-p90 ribosomal S6 kinase-cyclic AMP response element-binding protein signaling pathway.

Product Specifications

Product Name Alternative

Cytokine ML-1||IL-17F||Interleukin-17F precursor||IL17F||ML1||ML-1.

Purification

Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

IL17F was lyophilized from a concentrated (1mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Galectin-8 ELISA Kit
MBS3807029-01 48 Well

Mouse Galectin-8 ELISA Kit

Ask
View Details
Mouse Galectin-8 ELISA Kit
MBS3807029-02 96 Well

Mouse Galectin-8 ELISA Kit

Ask
View Details
Mouse Galectin-8 ELISA Kit
MBS3807029-03 5x 96 Well

Mouse Galectin-8 ELISA Kit

Ask
View Details
Mouse Galectin-8 ELISA Kit
MBS3807029-04 10x 96 Well

Mouse Galectin-8 ELISA Kit

Ask
View Details
GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (MaxLight 750) discontinued
G8960-02M-ML750 100 µL

GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (MaxLight 750) discontinued

Ask
View Details
INO80B (NM_031288) Human Over-expression Lysate
LS083444-20ug 20 µg

INO80B (NM_031288) Human Over-expression Lysate

Ask
View Details