Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIL 17E Recombinant Protein

Source : Escherichia Coli. Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques. IL-25 also called IL-17E cytokine has a sequence similarity with IL17. IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesn't induce allergic inflammation in vivo.

Product Specifications

Product Name Alternative

IL-25||IL-17E||IL17E||IL25||Interleukin-25.

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

IL17E was lyophilized from a concentrated (1mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.

Amino Acids

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Transgelin 2 (TAGLN2) ELISA Kit
MBS4502726-01 48 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Ask
View Details
Human Transgelin 2 (TAGLN2) ELISA Kit
MBS4502726-02 96 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Ask
View Details
Human Transgelin 2 (TAGLN2) ELISA Kit
MBS4502726-03 5x 96 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Ask
View Details
Human Transgelin 2 (TAGLN2) ELISA Kit
MBS4502726-04 10x 96 Tests

Human Transgelin 2 (TAGLN2) ELISA Kit

Ask
View Details
Lcat Mouse Gene Knockout Kit (CRISPR)
KN509158 1 Kit

Lcat Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)
MBS2074786-01 0.1 mL

APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)

Ask
View Details