Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 13 Recombinant Protein

Source : Escherichia Coli. Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques. IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Product Specifications

Product Name Alternative

NC30||ALRH||BHR1||P600||IL-13||MGC116786||MGC116788||MGC116789.

Purification

Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein (1mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Storage Conditions

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg.

Amino Acids

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HES1, NT (HES1, BHLHB39, HL, HRY, Transcription factor HES-1, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein) (AP)
MBS6306208-01 0.2 mL

HES1, NT (HES1, BHLHB39, HL, HRY, Transcription factor HES-1, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein) (AP)

Ask
View Details
HES1, NT (HES1, BHLHB39, HL, HRY, Transcription factor HES-1, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein) (AP)
MBS6306208-02 5x 0.2 mL

HES1, NT (HES1, BHLHB39, HL, HRY, Transcription factor HES-1, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein) (AP)

Ask
View Details
Rat TAF1A (Tata Box Binding Protein Associated Factor 1A) ValidElisa Kit
EK342884 96 Well

Rat TAF1A (Tata Box Binding Protein Associated Factor 1A) ValidElisa Kit

Ask
View Details
TMEM238 Human shRNA Plasmid Kit (Locus ID 388564)
TL320171 1 Kit

TMEM238 Human shRNA Plasmid Kit (Locus ID 388564)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)
MBS2074947-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)
MBS2074947-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)

Ask
View Details