MIL 4 Recombinant Protein
Source : Escherichia coli. Interleukin-4 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids and having a molecular mass of 13500 Dalton. The IL-4 is purified by proprietary chromatographic techniques. Interleukin-4 is a pleiotropic cytokine produced primarily by activated T lymphocytes, basophils and mast cells. Multiple immune response-modulating functions are performed by IL-4 on a variety of cell types and it has an important role in the regulator of isotype switching, induction of IgE production in B lymphocytes and differentiation of precursor T helper cells. IL-4 binds to both membrane-bound and secreted soluble IL-4 receptors.
Product Specifications
Product Name Alternative
BCGF||BCDF||B cell stimulating factor||BSF-1||Lymphocyte stimulatory factor 1||IL-4||MGC79402||Binetrakin||Pitrakinra.
Purification
Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Lyophilized from a 0.2μm concentrated (1mg/mL) solution in PBS pH 7.4.
Storage Conditions
Applications Notes
Amino Acids
MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS.
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog