Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIL 4 Recombinant Protein

Source : Escherichia coli. Interleukin-4 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids and having a molecular mass of 13500 Dalton. The IL-4 is purified by proprietary chromatographic techniques. Interleukin-4 is a pleiotropic cytokine produced primarily by activated T lymphocytes, basophils and mast cells. Multiple immune response-modulating functions are performed by IL-4 on a variety of cell types and it has an important role in the regulator of isotype switching, induction of IgE production in B lymphocytes and differentiation of precursor T helper cells. IL-4 binds to both membrane-bound and secreted soluble IL-4 receptors.

Product Specifications

Product Name Alternative

BCGF||BCDF||B cell stimulating factor||BSF-1||Lymphocyte stimulatory factor 1||IL-4||MGC79402||Binetrakin||Pitrakinra.

Purification

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm concentrated (1mg/mL) solution in PBS pH 7.4.

Storage Conditions

Lyophilized Interleukin-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL4 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Interleukin 4 in sterile 10mM HAc not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by the dose-dependant induction of HT-2 cell proliferation is less than 2 ng/ml corresponding to a Specific Activity of 500,000IU/mg.

Amino Acids

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFATC2 Polyclonal Antibody
MBS2527211-01 0.02 mL

NFATC2 Polyclonal Antibody

Ask
View Details
NFATC2 Polyclonal Antibody
MBS2527211-02 0.06 mL

NFATC2 Polyclonal Antibody

Ask
View Details
NFATC2 Polyclonal Antibody
MBS2527211-03 0.12 mL

NFATC2 Polyclonal Antibody

Ask
View Details
NFATC2 Polyclonal Antibody
MBS2527211-04 0.2 mL

NFATC2 Polyclonal Antibody

Ask
View Details
NFATC2 Polyclonal Antibody
MBS2527211-05 5x 0.2 mL

NFATC2 Polyclonal Antibody

Ask
View Details
Oxalic Acid-13C2 Dibutyl Ester
MBS6023753-01 2.5 mg

Oxalic Acid-13C2 Dibutyl Ester

Ask
View Details