Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIL 4 Recombinant Protein

Source : Escherichia coli. Interleukin-4 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids and having a molecular mass of 13500 Dalton. The IL-4 is purified by proprietary chromatographic techniques. Interleukin-4 is a pleiotropic cytokine produced primarily by activated T lymphocytes, basophils and mast cells. Multiple immune response-modulating functions are performed by IL-4 on a variety of cell types and it has an important role in the regulator of isotype switching, induction of IgE production in B lymphocytes and differentiation of precursor T helper cells. IL-4 binds to both membrane-bound and secreted soluble IL-4 receptors.

Product Specifications

Product Name Alternative

BCGF||BCDF||B cell stimulating factor||BSF-1||Lymphocyte stimulatory factor 1||IL-4||MGC79402||Binetrakin||Pitrakinra.

Purification

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm concentrated (1mg/mL) solution in PBS pH 7.4.

Storage Conditions

Lyophilized Interleukin-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL4 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Interleukin 4 in sterile 10mM HAc not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by the dose-dependant induction of HT-2 cell proliferation is less than 2 ng/ml corresponding to a Specific Activity of 500,000IU/mg.

Amino Acids

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Myl7 Mouse Gene Knockout Kit (CRISPR)
KN510612 1 Kit

Myl7 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Protein-A/G/L-Cys
OM305589-01 1 mg

Protein-A/G/L-Cys

Ask
View Details
Protein-A/G/L-Cys
OM305589-02 10 mg

Protein-A/G/L-Cys

Ask
View Details
Protein-A/G/L-Cys
OM305589-03 100 mg

Protein-A/G/L-Cys

Ask
View Details
Guinea pig Carbonic anhydrase 4 (CA4) ELISA Kit
MBS7218333-01 48 Well

Guinea pig Carbonic anhydrase 4 (CA4) ELISA Kit

Ask
View Details
Guinea pig Carbonic anhydrase 4 (CA4) ELISA Kit
MBS7218333-02 96 Well

Guinea pig Carbonic anhydrase 4 (CA4) ELISA Kit

Ask
View Details