Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 1 alpha Recombinant Protein

Source : Escherichia Coli. Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton. The IL-1A is purified by proprietary chromatographic techniques. IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Product Specifications

Product Name Alternative

Hematopoietin-1||Lymphocyte-activating factor (LAF) ||Endogenous Pyrogen (EP) ||Leukocyte Endogenous Mediator (LEM) ||Mononuclear Cell Factor (MCF) ||IL-1 alpha, IL1||IL-1A||IL1F1.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein was lyophilized from a concentrated (1mg/mL) sterile solution containing 25mM Tris-HCl, pH 8.

Storage Conditions

Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg.

Amino Acids

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gja5 Antibody
OABB00327-100UG 100 µg/Vial

Gja5 Antibody

Sign In for Pricing
View Details
Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit
KTE61497-01 48 Tests

Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit

Sign In for Pricing
View Details
Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit
KTE61497-02 96 Tests

Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit

Sign In for Pricing
View Details
Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit
KTE61497-03 5x 96 Tests

Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit

Sign In for Pricing
View Details
Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit
KTE61497-04 50x 96 Tests

Human Fanconi-associated nuclease 1 (MTMR15) ELISA Kit

Sign In for Pricing
View Details
(Nle4,D-Phe7)-a-MSH
H-1100.0001 1.0mg

(Nle4,D-Phe7)-a-MSH

Sign In for Pricing
View Details