Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMF b Recombinant Protein

Source : Escherichia Coli. Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques. Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve gorwth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta inhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Although astrocytes produce GMF-b and stores it inside the cells, they don't secrete the GMF-B into the cultured medium. Cell- surface GMFb acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells.GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.

Product Specifications

Product Name Alternative

Glia maturation factor beta||GMFB||GMF-B||GMF-beta||GMF.

Purification

Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.

Storage Conditions

Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized GMFB in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ube2e2 3'UTR Lenti-reporter-Luc Vector
48967084 1.0 µg

Ube2e2 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit
MBS160595-01 48 Well

Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit

Ask
View Details
Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit
MBS160595-02 96 Well

Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit

Ask
View Details
Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit
MBS160595-03 5x 96 Well

Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit

Ask
View Details
Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit
MBS160595-04 10x 96 Well

Human Golgi Phosphoprotein 3 (GOLPH3) ELISA Kit

Ask
View Details
CCL26 Over-expression Lysate Product
GWB-E5F4B7 0.1 mg

CCL26 Over-expression Lysate Product

Ask
View Details