Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCNTF Recombinant Protein

Source : Escherichia Coli. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques. CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Product Specifications

Product Name Alternative

HCNTF||CNTF||Ciliary Neurotrophic Factor.

Purification

Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a concentrated (1mg/mL) solution in water containing 0.025% NaHCO3.

Storage Conditions

Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100μg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.

Amino Acids

AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tumor necrosis factor (TNF-alpha) (77-233) Human Protein
SA6055X 500 µg

Tumor necrosis factor (TNF-alpha) (77-233) Human Protein

Ask
View Details
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial
MBS1436565-01 0.02 mg (E-Coli)

Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial

Ask
View Details
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial
MBS1436565-02 0.1 mg (E-Coli)

Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial

Ask
View Details
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial
MBS1436565-03 1 mg (E-Coli)

Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial

Ask
View Details
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial
MBS1436565-04 5x 1 mg (E-Coli)

Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8) , partial

Ask
View Details
Chicken Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit
MBS2611357-01 48 Well

Chicken Receptor I For The Fc Region Of Immunoglobulin G (FcgammaRI) ELISA Kit

Ask
View Details