Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP Protein

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Product Specifications

Product Name Alternative

NPPB||Natriuretic Peptide Precursor B||BNP||B-type Natriuretic Peptide.

Purification

Greater than 95.0% as determined by RP-HPLC.

Components

The protein was lyophilized without additives.

Storage Conditions

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chicken Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
SL0078Ch-01 48 Tests

Chicken Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Ask
View Details
Chicken Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
SL0078Ch-02 96 Tests

Chicken Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Ask
View Details
PCMV-LATS2 (human) -P2A-EYFP-AMOT (human) -Neo
BZ61770 1 Vial

PCMV-LATS2 (human) -P2A-EYFP-AMOT (human) -Neo

Ask
View Details
Substance P Receptor, aa385-407 (NK1 Receptor, Neurokinin Receptor) discontinued see S8000-50
S8000-51 50 µL

Substance P Receptor, aa385-407 (NK1 Receptor, Neurokinin Receptor) discontinued see S8000-50

Ask
View Details
Krtap1-5 (NM_027157) Mouse Untagged Clone
MC210980 10 µg

Krtap1-5 (NM_027157) Mouse Untagged Clone

Ask
View Details
4-Propanoyloxy DMT
HY-145464 1 Each

4-Propanoyloxy DMT

Ask
View Details