BNP Protein
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Product Specifications
Product Name Alternative
NPPB||Natriuretic Peptide Precursor B||BNP||B-type Natriuretic Peptide.
Purification
Greater than 95.0% as determined by RP-HPLC.
Components
The protein was lyophilized without additives.
Storage Conditions
Applications Notes
Amino Acids
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items