Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP Recombinant Protein

Source : Escherichia Coli. B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques. Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Product Specifications

Product Name Alternative

NPPB||Natriuretic Peptide Precursor B||BNP||B-type Natriuretic Peptide.

Purification

Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.

Storage Conditions

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UE-01 25 µg

APC Anti-Mouse IgM Antibody[RMM-1]

Ask
View Details
APC Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UE-02 100 µg

APC Anti-Mouse IgM Antibody[RMM-1]

Ask
View Details
Rabbit Polyclonal Oncomodulin/OCM2 Antibody
NBP3-17610-25ul 25 µL

Rabbit Polyclonal Oncomodulin/OCM2 Antibody

Ask
View Details
ELN Polyclonal Antibody
MBS8567307-01 0.1 mL

ELN Polyclonal Antibody

Ask
View Details
ELN Polyclonal Antibody
MBS8567307-02 0.1 mL (AF405L)

ELN Polyclonal Antibody

Ask
View Details
ELN Polyclonal Antibody
MBS8567307-03 0.1 mL (AF405S)

ELN Polyclonal Antibody

Ask
View Details