Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ProNGF Recombinant Protein

Source : Escherichia Coli. Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

Product Specifications

Product Name Alternative

Human Pro-NGF||ProNGF||NGFB.

Purification

Greater than 95.0% as determined by SDS-PAGE.

Components

ProNGF was lyophilized from a 0.2μm filtered solution of 20mM PB and 250mM NaCl pH 7.2.

Storage Conditions

Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPC4 Peptide (AAP40496)
AAP40496-100UG 100 µg

PABPC4 Peptide (AAP40496)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Protein repA (repA)
MBS1011006-01 0.02 mg (E-Coli)

Recombinant Lactobacillus plantarum Protein repA (repA)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Protein repA (repA)
MBS1011006-02 0.1 mg (E-Coli)

Recombinant Lactobacillus plantarum Protein repA (repA)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Protein repA (repA)
MBS1011006-03 0.02 mg (Yeast)

Recombinant Lactobacillus plantarum Protein repA (repA)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Protein repA (repA)
MBS1011006-04 0.1 mg (Yeast)

Recombinant Lactobacillus plantarum Protein repA (repA)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Protein repA (repA)
MBS1011006-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus plantarum Protein repA (repA)

Sign In for Pricing
View Details