Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP 7 Plant Recombinant Protein

Source : Nicotiana benthamiana. Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques. The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

Product Specifications

Product Name Alternative

Osteogenic Protein 1||BMP-7.

Purification

Greater than 97.0% as determined by SDS-PAGE.

Components

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Storage Conditions

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/μl. The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Amino Acids

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3-Acetyl-5-bromopyridine
423625-01 1 g

3-Acetyl-5-bromopyridine

Ask
View Details
3-Acetyl-5-bromopyridine
423625-02 5 g

3-Acetyl-5-bromopyridine

Ask
View Details
VAMP1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61962R-APC-Cy7 100 µL

VAMP1 Recombinant Antibody, APC-Cy7 Conjugated

Ask
View Details
Human PGP knockdown cell line
ABC-KD11466 1 Vial

Human PGP knockdown cell line

Ask
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (APC)
168873-AF-APC 100 µL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (APC)

Ask
View Details
Recombinant Acidobacterium capsulatum Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1031053-01 0.02 mg (E-Coli)

Recombinant Acidobacterium capsulatum Crossover junction endodeoxyribonuclease RuvC (ruvC)

Ask
View Details