Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFF R Recombinant Protein

Source : Escherichia Coli. B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques. B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE) . Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.

Product Specifications

Product Name Alternative

TNFRSF13C||CD268||BAFF-R||MGC138235||B cell-activating factor receptor.

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 8.0, 500mM NaCl.

Storage Conditions

Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 μg/ml in the presence of 1.0μg/ml of human soluble BAFF.

Amino Acids

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3057-5p agomir
HY-R02901A-01 5 nmol

Mmu-miR-3057-5p agomir

Sign In for Pricing
View Details
Mmu-miR-3057-5p agomir
HY-R02901A-02 20 nmol

Mmu-miR-3057-5p agomir

Sign In for Pricing
View Details
ZNF157 sgRNA CRISPR Lentivector (Human) (Target 3)
K2689204 1.0 µg DNA

ZNF157 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FOXO1 Rabbit Polyclonal Antibody (PerCP)
orb1604383 100 µL

FOXO1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
SIRT2 Antibody
A21477-100UG 100 µg

SIRT2 Antibody

Sign In for Pricing
View Details
Septin 12 Double Nickase Plasmid (m)
sc-427876-NIC 20 µg

Septin 12 Double Nickase Plasmid (m)

Sign In for Pricing
View Details