Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIF1 Recombinant Protein

Source : E. Coli. The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag. Human AIF1 protein shares 98% homology/identity with that of rat. AIF1 is expressed in macrophages and neutrophils. The expression of AIF1 transcripts is upregulated by IFN-g in rat macrophages. AIF1 is expressed selectively in human macrophage-like cell lines, and in a subset of CD68 (+) macrophages in the interstitial and perivascular spaces of human heart allografts. In quiescent cultured human vascular smooth muscle cells synthesis of AIF1 is induced by IFN-g, IL1b, and conditioned medium of T-cells. Overexpression of AIF1 in human VSMCs results in enhanced growth of these cells. AIF1 is expressed during apoptosis rat mammary gland and ventral prostate tissues. Allograft Inflammatory Factor 1 is expressed by several tumor-associated activated macrophages and microglial cells in rat and human gliomas. There is an evident relationship of AIF1-expressing activated macrophages and microglial cells with tumor malignancy in humans.

Product Specifications

Product Name Alternative

AIF-1||Allograft inflammatory factor 1||Em:AF129756.17||G1||IBA1||Ionized calcium-binding adapter molecule 1||IRT-1||Protein G1||AIF1.

Purification

Greater than 90% as determined by SDS PAGE.

Components

Filtered and lyophilized from 0.5mg/mL in 20mM Tris buffer and 50mM NaCl pH-7.5.

Storage Conditions

For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C.

Applications Notes

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.

Amino Acids

MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA1 Knockout DLD-1 Polyclonal Cells
ARG35499 1 Million

ACTA1 Knockout DLD-1 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant deltaNp63 Antibody / p40
V9359-20UG 20 µg

Recombinant deltaNp63 Antibody / p40

Sign In for Pricing
View Details
Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
TRV-0060171-01 20 µL

Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
TRV-0060171-02 100 µL

Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
TRV-0060171-03 200 µL

Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)
TRV-0060171-04 1 mL

Monoclonal Antibody to Receptor Activity Modifying Protein 2 (RAMP2)

Sign In for Pricing
View Details