Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acrp30 Recombinant Protein

Source : Escherichia Coli. The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244) . The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30) . Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.

Product Specifications

Product Name Alternative

Acrp30||AdipoQ||GBP-28||APM-1||ACDC.

Purification

Acrp30 is greater than 90% as determined by SDS-PAGE.

Components

Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles.

Amino Acids

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SULT1C2 Antibody
MBS969062-01 0.05 mL

SULT1C2 Antibody

Ask
View Details
SULT1C2 Antibody
MBS969062-02 0.1 mL

SULT1C2 Antibody

Ask
View Details
SULT1C2 Antibody
MBS969062-03 5x 0.1 mL

SULT1C2 Antibody

Ask
View Details
LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (AP)
MBS6485451-01 0.2 mL

LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (AP)

Ask
View Details
LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (AP)
MBS6485451-02 5x 0.2 mL

LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (AP)

Ask
View Details
Human ASB16 knockdown cell line
ABC-KD1057 1 Vial

Human ASB16 knockdown cell line

Ask
View Details