Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant PDGF Protein

Source: E. coli. MW: ~16.2kDa.

Product Specifications

Components

50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol.

Storage Conditions

Store at–20°C

Amino Acids

MEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISR RLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEILEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-02 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-03 0.1 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-04 0.1 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-05 0.02 mg (Baculovirus)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-06 0.02 mg (Mammalian-Cell)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details