Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant PDGF Protein

Source: E. coli. MW: ~16.2kDa.

Product Specifications

Components

50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol.

Storage Conditions

Store at–20°C

Amino Acids

MEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISR RLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEILEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAZ Recombinant Protein
OPCD00544-10UG 10 µg

GNAZ Recombinant Protein

Sign In for Pricing
View Details
Tm7sf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7320606 1.0 µg DNA

Tm7sf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ethylhexylglycerin
orb2664738-01 1 ml x 10 mM (in DMSO)

Ethylhexylglycerin

Sign In for Pricing
View Details
Ethylhexylglycerin
orb2664738-02 10 g

Ethylhexylglycerin

Sign In for Pricing
View Details
Mouse Polyclonal THG1L Antibody
H00054974-B01P 0.05 mg

Mouse Polyclonal THG1L Antibody

Sign In for Pricing
View Details
CAVIN1 (C-term) Rabbit Polyclonal Antibody
AP14067PU-N 400 µL

CAVIN1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details