SARS CoV2 Spike S1 C-Term His Tag Protein
Source: Covid 19 Spike S1-His in CHO-K1.The spike protein (S1) of coronavirus (CoV2) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2) . A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Product Specifications
Components
50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol
Storage Conditions
Store at–20°C
Amino Acids
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEER GVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKR TGQYKLGSKTGPGQKAILFLPMSAKS
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items