Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE2 Recombinant protein

Product Specifications

Product Name Alternative

Angiotensin-converting enzyme homolog, Angiotensin-converting enzyme-related carboxypeptidase, Metalloprotease MPROT15

Gene Name

ACE2

Gene ID

59272

UniProt

Q9BYF1

Purification

>95% by SDS-PAGE.

Components

0.5 mg/mL in 50 mM Tris, pH-7.4, 300 mM NaCl and 10% Glycerol

Storage Conditions

ACE2 Protein is shipped on ice packs. Upon arrival, Store at -20°C. Do not freeze-thaw multiple times.

Amino Acids

MDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1LG2 siRNA (Human)
orb1855382-01 15 nmol

PDCD1LG2 siRNA (Human)

Sign In for Pricing
View Details
PDCD1LG2 siRNA (Human)
orb1855382-02 30 nmol

PDCD1LG2 siRNA (Human)

Sign In for Pricing
View Details
APC anti-human CD200 Receptor
E16FHA200R-025 25 Tests

APC anti-human CD200 Receptor

Sign In for Pricing
View Details
Human cholesterol ELISA Kit
ELA-E1701h 96 Tests

Human cholesterol ELISA Kit

Sign In for Pricing
View Details
LARP7 Double Nickase Plasmid (m2)
sc-424314-NIC-2 20 µg

LARP7 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
OLFR1280 Adenovirus (Mouse)
32738054 1.0 mL

OLFR1280 Adenovirus (Mouse)

Sign In for Pricing
View Details