Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE2 Recombinant protein

Product Specifications

Product Name Alternative

Angiotensin-converting enzyme homolog, Angiotensin-converting enzyme-related carboxypeptidase, Metalloprotease MPROT15

Gene Name

ACE2

Gene ID

59272

UniProt

Q9BYF1

Purification

>95% by SDS-PAGE.

Components

0.5 mg/mL in 50 mM Tris, pH-7.4, 300 mM NaCl and 10% Glycerol

Storage Conditions

ACE2 Protein is shipped on ice packs. Upon arrival, Store at -20°C. Do not freeze-thaw multiple times.

Amino Acids

MDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody
abx141655-01 50 µL

O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody

Sign In for Pricing
View Details
O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody
abx141655-02 100 µL

O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody

Sign In for Pricing
View Details
O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody
abx141655-03 200 µL

O-Linked N-Acetylglucosamine (GlcNAc) Transferase (OGT) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal NDFIP1 Antibody [DyLight 680]
NBP2-82012FR 0.1 mL

Rabbit Polyclonal NDFIP1 Antibody [DyLight 680]

Sign In for Pricing
View Details
Slit Homolog 1 (Biotin)
549975 200 µL

Slit Homolog 1 (Biotin)

Sign In for Pricing
View Details
LYRM5 cDNA Clone
MBS1266548-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

LYRM5 cDNA Clone

Sign In for Pricing
View Details