Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PD-L1 Fc Fusion Protein (Active)

Host: CHO-K1 celline. PD-L1 (CD274/B7-H1) is a critical membrane-bound costimulatory molecule belongs to the B7 superfamily that inhibits immune responses through its receptor, PD-1 and PD-L1 play a key role in the pathogenesis of inflammatory diseases (programmed death 1) . It is widely expressed in the mononuclear phagocyte system (MPS), may co-stimulate T cells and regulates inflammatory responses. PD-L1 exerts inflammation regulatory functions via a negative co-stimulatory effect on T cell functions to inhibit cytokine secretion, facilitate apoptosis of activated T cells and induce T cell anergy. Aberrant expression and dysregulation of CD274 have been reported during bacterial infection, inflammation and in numerous autoimmune diseases.

Product Specifications

Product Name Alternative

B7 homolog 1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1

Applications

Functional Assay, ELISA, FACS, WB

Purification

99% Purity SDS -PAGE and HPLC.

Components

Lyophilized sterile PBS, 5% trehalose and 0.01% tween 80 are added as protectant before lyophilization.

Storage Conditions

Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Applications Notes

Functional assay: Measured by its binding ability in a functional FLOW . Binding assay was tested using CHO-K1/PD-1 (cat no. 14-500ACL) . Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method

Amino Acids

Human PD-L1 (ECD) : MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPV EKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLL KDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA PYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLS GKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENH TAELVIPELPLAHPPNER
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Toll Like Receptor 3 (Biotin)
550260 200 µL

Toll Like Receptor 3 (Biotin)

Ask
View Details
HRP-Linked Polyclonal Antibody to Agrin (AGRN)
MBS2053687-01 0.1 mL

HRP-Linked Polyclonal Antibody to Agrin (AGRN)

Ask
View Details
HRP-Linked Polyclonal Antibody to Agrin (AGRN)
MBS2053687-02 0.2 mL

HRP-Linked Polyclonal Antibody to Agrin (AGRN)

Ask
View Details
HRP-Linked Polyclonal Antibody to Agrin (AGRN)
MBS2053687-03 0.5 mL

HRP-Linked Polyclonal Antibody to Agrin (AGRN)

Ask
View Details
HRP-Linked Polyclonal Antibody to Agrin (AGRN)
MBS2053687-04 1 mL

HRP-Linked Polyclonal Antibody to Agrin (AGRN)

Ask
View Details
HRP-Linked Polyclonal Antibody to Agrin (AGRN)
MBS2053687-05 5 mL

HRP-Linked Polyclonal Antibody to Agrin (AGRN)

Ask
View Details