Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-FABP4 Polyclonal Antibody

Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

Product Specifications

Product Name Alternative

Fatty acid-binding protein, adipocyte; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4; FABP4

Gene Name

FABP4

Gene ID

2167

UniProt

P15090

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences.

Target Antigen

Fatty acid-binding protein, adipocyte

Clonality

Polyclonal

Applications

WB, IHC-P

Purification

Immunogen affinity purified.

Format

Lyophilized

Components

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/mL.

Storage Conditions

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Applications Notes

Western blot : 0.1-0.5μg/ml; Immunohistochemistry (Paraffin-embedded Section) : 0.5-1μg/ml

Isotype

Rabbit IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7035-5p miRNA Antagomir
CIN1541-01 10 nmol

Mmu-miR-7035-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7035-5p miRNA Antagomir
CIN1541-02 20 nmol

Mmu-miR-7035-5p miRNA Antagomir

Sign In for Pricing
View Details
OR2T7 (C-term) Rabbit pAb
E2619306 100 µL

OR2T7 (C-term) Rabbit pAb

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)
MBS2073576-01 0.1 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)
MBS2073576-02 0.2 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)
MBS2073576-03 0.5 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 12 (TNFSF12)

Sign In for Pricing
View Details