Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Human (HEK293, His)

The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (HEK293, His) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-human-hek293-his.html

Purity

95.00

Smiles

RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

Molecular Formula

921 (Gene_ID) P06127 (R25-P372) (Accession)

Molecular Weight

Approximately 48.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

40nm Endotoxin Free Silver Nanoparticles
SEF-40-1000 1000 mL

40nm Endotoxin Free Silver Nanoparticles

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)
MBS2054752-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)
MBS2054752-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)
MBS2054752-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)
MBS2054752-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)
MBS2054752-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4)

Ask
View Details