Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Human (HEK293, His)

The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (HEK293, His) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-human-hek293-his.html

Purity

95.00

Smiles

RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

Molecular Formula

921 (Gene_ID) P06127 (R25-P372) (Accession)

Molecular Weight

Approximately 48.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-01 0.02 mg (E-Coli)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-02 0.02 mg (Yeast)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-03 0.1 mg (E-Coli)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-04 0.1 mg (Yeast)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-05 0.02 mg (Baculovirus)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial
MBS7053614-06 0.02 mg (Mammalian-Cell)

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23), partial

Ask
View Details