Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone deacetylase 7 (HDAC7) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

HDAC7

UniProt

Q8WUI4 (BC064840)

Expression Region

4-203aa

Organism

Homo sapiens

Target Sequence

PGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYK

Tag

N-terminal 6xHis-tagged

Source

E.coli

Field of Research

Transcription

Assay Type

In Stock Protein

Relevance

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors . May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Positively regulates the transcriptional repressor activity of FOXP3 .

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial of BC064840

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26 kDa

References & Citations

"The finished DNA sequence of human chromosome 12."Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)
PT_73983-01 5 µg

Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)

Sign In for Pricing
View Details
Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)
PT_73983-02 20 µg

Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)

Sign In for Pricing
View Details
Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)
PT_73983-03 1 mg

Granulocyte Macrophage-Colony Stimulating Factor Human Recombinant (GM CSF Human)

Sign In for Pricing
View Details
MyD88  polyclonal antibody
BS79579 50ul

MyD88 polyclonal antibody

Sign In for Pricing
View Details
Syntaxin 4 Recombinant Antibody, PerCP Conjugated
bsm-62037R-PerCP 100 µL

Syntaxin 4 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human Colony Stimulating Factor 1, Macrophage (MCSF) Mini Samples ELISA Kit
MBS2708246-01 24 Strip Well

Human Colony Stimulating Factor 1, Macrophage (MCSF) Mini Samples ELISA Kit

Sign In for Pricing
View Details