Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (HEK293, hFc)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (HEK293, hFc) is the recombinant human-derived MIF protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-hek293-hfc.html

Purity

94.00

Smiles

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (P2-A115) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasma Protease C1 Inhibitor (SERPING1) Antibody
abx405301-01 100 µL

Plasma Protease C1 Inhibitor (SERPING1) Antibody

Sign In for Pricing
View Details
Plasma Protease C1 Inhibitor (SERPING1) Antibody
abx405301-02 200 µL

Plasma Protease C1 Inhibitor (SERPING1) Antibody

Sign In for Pricing
View Details
Plasma Protease C1 Inhibitor (SERPING1) Antibody
abx405301-03 1 mL

Plasma Protease C1 Inhibitor (SERPING1) Antibody

Sign In for Pricing
View Details
Human RPL29 Pre-designed siRNA Set A
SI013992A 1 Each

Human RPL29 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lrrc68 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3351906 1.0 µg DNA

Lrrc68 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Guinea Pig CXC chemokine receptor 1 ELISA kit
GTR10371256 96 Well

Guinea Pig CXC chemokine receptor 1 ELISA kit

Sign In for Pricing
View Details