Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Mouse

MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-mouse.html

Purity

97.00

Smiles

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Molecular Formula

20307 (Gene_ID) Q9Z121 (G24-P97) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yuan-Yuan Deng, et al. Immunomodulatory activity and partial characterisation of polysaccharides from Momordica charantia. Molecules. 2014 Aug 29;19 (9) :13432-47.|[4]Kiyokazu Hiwatashi, et al. Suppression of SOCS3 in macrophages prevents cancer metastasis by modifying macrophage phase and MCP2/CCL8 induction. Cancer Lett. 2011 Sep 28;308 (2) :172-80.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit
MBS7238056-01 48 Well

Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit
MBS7238056-02 96 Well

Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit
MBS7238056-03 5x 96 Well

Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit
MBS7238056-04 10x 96 Well

Guinea pig C-type lectin domain family 5 member A (CLEC5A) ELISA Kit

Sign In for Pricing
View Details
Human Neurofilament protein H, NF-H ELISA KIT
E5758Hu-01 48 Well

Human Neurofilament protein H, NF-H ELISA KIT

Sign In for Pricing
View Details
Human Neurofilament protein H, NF-H ELISA KIT
E5758Hu-02 96 Well

Human Neurofilament protein H, NF-H ELISA KIT

Sign In for Pricing
View Details