Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-2/CCL8, Mouse

MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MCP-2/CCL8 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-mouse.html

Purity

97.00

Smiles

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Molecular Formula

20307 (Gene_ID) Q9Z121 (G24-P97) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yuan-Yuan Deng, et al. Immunomodulatory activity and partial characterisation of polysaccharides from Momordica charantia. Molecules. 2014 Aug 29;19 (9) :13432-47.|[4]Kiyokazu Hiwatashi, et al. Suppression of SOCS3 in macrophages prevents cancer metastasis by modifying macrophage phase and MCP2/CCL8 induction. Cancer Lett. 2011 Sep 28;308 (2) :172-80.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS2 Adenovirus (Human)
11805051 1.0 mL

ALS2 Adenovirus (Human)

Sign In for Pricing
View Details
Faropenem Sodium
S4847-25mg 25 mg

Faropenem Sodium

Sign In for Pricing
View Details
Arnolol
MBS5811039 Inquire

Arnolol

Sign In for Pricing
View Details
CRSP34 (B-7) HRP
sc-390296 HRP 200 µg/mL

CRSP34 (B-7) HRP

Sign In for Pricing
View Details
Chicken C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1) ELISA Kit
MBS7220412-01 48 Well

Chicken C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1) ELISA Kit

Sign In for Pricing
View Details
Chicken C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1) ELISA Kit
MBS7220412-02 96 Well

Chicken C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1) ELISA Kit

Sign In for Pricing
View Details