Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Decorin (DCN)

Product Specifications

Product Name Alternative

(Bone proteoglycan II) (PG-S2)

Abbreviation

Recombinant Bovine DCN protein

Gene Name

DCN

UniProt

P21793

Expression Region

31-360aa

Organism

Bos taurus (Bovine)

Target Sequence

DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May affect the rate of fibrils formation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.5 kDa

References & Citations

"Molecular cloning and sequence analysis of the cDNA for small proteoglycan II of bovine bone."Day A.A., McQuillan C.I., Termine J.D., Young M.R.Biochem. J. 248:801-805 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Curvus acpP Protein (aa 1-77)
VAng-Lsx5923-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Curvus acpP Protein (aa 1-77)

Sign In for Pricing
View Details
Canine ASP ELISA Kit
ECA0889 96 Tests

Canine ASP ELISA Kit

Sign In for Pricing
View Details
(-) -Kainic Acid, Monohydrate (([2S- (2a,3ß,4ß) ]-2-Caroxy-4- (1-methylethenyl) -3-pyrrolidineacetic Acid)
K0003-75 1 mg

(-) -Kainic Acid, Monohydrate (([2S- (2a,3ß,4ß) ]-2-Caroxy-4- (1-methylethenyl) -3-pyrrolidineacetic Acid)

Sign In for Pricing
View Details
V9 Human IgG1 (S239D/I332E) -Kappa Isotype control
BP368101-01 1 mg

V9 Human IgG1 (S239D/I332E) -Kappa Isotype control

Sign In for Pricing
View Details
V9 Human IgG1 (S239D/I332E) -Kappa Isotype control
BP368101-02 5 mg

V9 Human IgG1 (S239D/I332E) -Kappa Isotype control

Sign In for Pricing
View Details
V9 Human IgG1 (S239D/I332E) -Kappa Isotype control
BP368101-03 25 mg

V9 Human IgG1 (S239D/I332E) -Kappa Isotype control

Sign In for Pricing
View Details