Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2D, Mouse (HEK293, Fc)

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PLA2G2D protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PLA2G2D Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g2d-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

GLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC

Molecular Formula

18782 (Gene_ID) Q9WVF6-1 (G20-C144) (Accession)

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arimoclomol maleate
326988 10.0mg

Arimoclomol maleate

Sign In for Pricing
View Details
ZNF107 siRNA (Human)
MBS8240186-01 15 nmol

ZNF107 siRNA (Human)

Sign In for Pricing
View Details
ZNF107 siRNA (Human)
MBS8240186-02 30 nmol

ZNF107 siRNA (Human)

Sign In for Pricing
View Details
ZNF107 siRNA (Human)
MBS8240186-03 5x 30 nmol

ZNF107 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human VEGF165
PCH2544-01 1 Each

Recombinant Human VEGF165

Sign In for Pricing
View Details
Recombinant Human VEGF165
PCH2544-02 10 µg

Recombinant Human VEGF165

Sign In for Pricing
View Details