Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB10 (Ras-related Protein Rab-10) (MaxLight 405)
MBS6434487-01 0.1 mL

RAB10 (Ras-related Protein Rab-10) (MaxLight 405)

Sign In for Pricing
View Details
RAB10 (Ras-related Protein Rab-10) (MaxLight 405)
MBS6434487-02 5x 0.1 mL

RAB10 (Ras-related Protein Rab-10) (MaxLight 405)

Sign In for Pricing
View Details
Ptprn2 (NM_031600) Rat Tagged ORF Clone Lentiviral Particle
RR211823L4V 200 µL

Ptprn2 (NM_031600) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HXC10 Rabbit Polyclonal Antibody
E28PN0780 100 µL

HXC10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNX27 AAV Vector (Rat) (CMV)
45069106 1 µg

SNX27 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Rab39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6307507 1.0 µg DNA

Rab39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details