Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD36 knockdown cell line
ABC-KD0676 1 Vial

Human ANKRD36 knockdown cell line

Sign In for Pricing
View Details
Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (421)
NBP2-89594-100ul 100 µL

Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (421)

Sign In for Pricing
View Details
α1-acidglycoprotein Antibody, FITC conjugated
A14682-100UG 100 µg

α1-acidglycoprotein Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus psmA3 Protein (aa 1-22) (strain Newman)
VAng-Cr6089-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus psmA3 Protein (aa 1-22) (strain Newman)

Sign In for Pricing
View Details
OFD1P16Y Protein Vector (Human) (pPM-C-His)
PV105585 500 ng

OFD1P16Y Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-134-3p Virus
mh1600 250 µL

AdmiRa-hsa-miR-134-3p Virus

Sign In for Pricing
View Details