Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

T Lymphocytes discontinued
T8060-01 2 mL

T Lymphocytes discontinued

Sign In for Pricing
View Details
CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP)
MBS6374665-01 0.1 mL

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP)

Sign In for Pricing
View Details
CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP)
MBS6374665-02 5x 0.1 mL

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP)

Sign In for Pricing
View Details
CALR sgRNA CRISPR Lentivector (Human) (Target 3)
K0356704 1.0 µg DNA

CALR sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Rec8 activation kit by CRISPRa
GA206074 1 Kit

Mouse Rec8 activation kit by CRISPRa

Sign In for Pricing
View Details
PE Rabbit anti-Mouse CD14 mAb
A26053-01 100 Tests

PE Rabbit anti-Mouse CD14 mAb

Sign In for Pricing
View Details