Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (F-3) PE
sc-373897 PE 200 µg/mL

CD19 (F-3) PE

Sign In for Pricing
View Details
POLR2D Antibody, Biotin conjugated
A31603-50UG 50 µg

POLR2D Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human p150 CAF1 mAb
MA1310-01 50 μL

Rabbit Anti-Human p150 CAF1 mAb

Sign In for Pricing
View Details
Rabbit Anti-Human p150 CAF1 mAb
MA1310-02 100 μL

Rabbit Anti-Human p150 CAF1 mAb

Sign In for Pricing
View Details
Rat phosphorylated akt substrate of 160 kDa,AS160;TBC1D4 ELISA KIT
JOT-EK2887Ra 96 wells

Rat phosphorylated akt substrate of 160 kDa,AS160;TBC1D4 ELISA KIT

Sign In for Pricing
View Details
Prion protein PrP (PRNP) (NM_000311) Human Tagged ORF Clone Lentiviral Particle
RC205438L2V 200 µL

Prion protein PrP (PRNP) (NM_000311) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details