Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM85A Protein Vector (Human) (pPM-C-His)
PV077640 500 ng

FAM85A Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Bovine ADV-Ag ELISA Kit
EBA0749 96 Tests

Bovine ADV-Ag ELISA Kit

Sign In for Pricing
View Details
TRAPPC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B5]
TA505629AM 100 µL

TRAPPC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B5]

Sign In for Pricing
View Details
Recombinant Human Src kinase-associated phosphoprotein 1, His-SUMO, E.coli-10ug
QP7785-ec-10ug 10ug

Recombinant Human Src kinase-associated phosphoprotein 1, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 650)
MBS6223561-01 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 650)

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 650)
MBS6223561-02 5x 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 650)

Sign In for Pricing
View Details