Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP siRNA (Human)
CRH3546-01 15 nmol

PIP siRNA (Human)

Sign In for Pricing
View Details
PIP siRNA (Human)
CRH3546-02 30 nmol

PIP siRNA (Human)

Sign In for Pricing
View Details
Spag7 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4717703 1.0 µg DNA

Spag7 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Gp9 Antibody / Glycoprotein 9 / CD42a
FY12370 100 µg

Gp9 Antibody / Glycoprotein 9 / CD42a

Sign In for Pricing
View Details
NUDT12 Mouse Monoclonal Antibody [Clone ID: LBI5E8]
AMM16995V 100 µL

NUDT12 Mouse Monoclonal Antibody [Clone ID: LBI5E8]

Sign In for Pricing
View Details
TIGD3 Antibody (C-term) Blocking peptide
MBS9218080-01 0.5 mg

TIGD3 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details