Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP6 (Rho GTPase Activating Protein 6, RHOGAP6, RHOGAPX-1) (MaxLight 650)
243451-ML650 100 µL

ARHGAP6 (Rho GTPase Activating Protein 6, RHOGAP6, RHOGAPX-1) (MaxLight 650)

Sign In for Pricing
View Details
KYNUP1 Recombinant Protein (Human)
RP067740 100 µg

KYNUP1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Olr202 Protein Vector (Rat) (pPB-C-His)
PV289294 500 ng

Olr202 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Heparanase (HPA) BioAssayTM ELISA Kit (Human)
383283 96 Tests

Heparanase (HPA) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Anti-Kallikrein 11 Antibody
CPA2525-01 30 µL

Anti-Kallikrein 11 Antibody

Sign In for Pricing
View Details
Anti-Kallikrein 11 Antibody
CPA2525-02 50 μL

Anti-Kallikrein 11 Antibody

Sign In for Pricing
View Details