Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf85 Human qPCR Primer Pair (NM_182505)
HP219062 200 Reactions

C9orf85 Human qPCR Primer Pair (NM_182505)

Sign In for Pricing
View Details
Recombinant Macaque FLT3L/ Flt3 ligand Protein, Untagged, E.coli-10ug
QP10447-ec-10ug 10ug

Recombinant Macaque FLT3L/ Flt3 ligand Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated
MF-0136709-01 5 µg

SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated
MF-0136709-02 10 µg

SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated
MF-0136709-03 20 µg

SARS-CoV-2 Spike S1 Protein (HV69-70 deletion & Y144 deletion & N501Y & A570D & D614G & P681H, His), Biotinylated

Sign In for Pricing
View Details
D4S234E (NSG1) (NM_014392) Human Recombinant Protein
TP322554 20 µg

D4S234E (NSG1) (NM_014392) Human Recombinant Protein

Sign In for Pricing
View Details