Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-202-3p miRNA Mimic
CMH0242-01 5 nmol

Hsa-miR-202-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-202-3p miRNA Mimic
CMH0242-02 10 nmol

Hsa-miR-202-3p miRNA Mimic

Sign In for Pricing
View Details
Anti-p27 KIP1 Antibody BIOTIN
STJ501544 100 µg

Anti-p27 KIP1 Antibody BIOTIN

Sign In for Pricing
View Details
Human PGRN (Progranulin) ValidElisa Kit
EK340846 96 Well

Human PGRN (Progranulin) ValidElisa Kit

Sign In for Pricing
View Details
PSMD5 Protein Vector (Human) (pPB-N-His)
PV033342 500 ng

PSMD5 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Calpain 3 (CAPN3) (NM_173088) Human Tagged Lenti ORF Clone
RC221186L4 10 µg

Calpain 3 (CAPN3) (NM_173088) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details