Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM60P7Y Protein Vector (Human) (pPB-N-His)
PV138075 500 ng

TRIM60P7Y Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Methyltetrazine-PEG13-NHS ester
HY-141271 1 Each

Methyltetrazine-PEG13-NHS ester

Sign In for Pricing
View Details
12-Ethoxynimbolinin B
TBW00728 5mg

12-Ethoxynimbolinin B

Sign In for Pricing
View Details
Recombinant human high affinity IgE receptor, α-chain (FcεRIα), Na-azide free
0709-1-050 500 µg

Recombinant human high affinity IgE receptor, α-chain (FcεRIα), Na-azide free

Sign In for Pricing
View Details
WFDC2 Polyclonal Antibody
MBS2541509-01 0.06 mL

WFDC2 Polyclonal Antibody

Sign In for Pricing
View Details
WFDC2 Polyclonal Antibody
MBS2541509-02 0.12 mL

WFDC2 Polyclonal Antibody

Sign In for Pricing
View Details