Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natriuretic Peptide Receptor A, NT (NPR1, ANPRA, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor type A, Guanylate cyclase A) (MaxLight 750) discontinued
038811-ML750 100 µL

Natriuretic Peptide Receptor A, NT (NPR1, ANPRA, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor type A, Guanylate cyclase A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RHOA (Ras Homolog Gene Family, Member A, ARH12, ARHA, RHO12, RHOH12) (MaxLight 490)
251104-ML490 100 µL

RHOA (Ras Homolog Gene Family, Member A, ARH12, ARHA, RHO12, RHOH12) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal AHI1 Antibody [DyLight 594]
NBP1-78206DL594 0.1 mL

Rabbit Polyclonal AHI1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Dicer Antibody
E55A15335 100 µg

Dicer Antibody

Sign In for Pricing
View Details
TMEM252 (NM_153237) Human Recombinant Protein
TP306657L 1 mg

TMEM252 (NM_153237) Human Recombinant Protein

Sign In for Pricing
View Details
PPIAP14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1698007 1.0 µg DNA

PPIAP14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details