Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dbt sgRNA CRISPR Lentivector set (Rat)
K6928601 3x 1.0 µg

Dbt sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
β-cyano-L-Alanine
HY-125773-01 50 mg

β-cyano-L-Alanine

Sign In for Pricing
View Details
β-cyano-L-Alanine
HY-125773-02 100 mg

β-cyano-L-Alanine

Sign In for Pricing
View Details
pEnCMV-CRIM1-circRNA5257-SV40-Neo Plasmid
PVT41167 2 µg

pEnCMV-CRIM1-circRNA5257-SV40-Neo Plasmid

Sign In for Pricing
View Details
Rabbit anti-MGRNl Antibody, Affinity Purified
A302-913A 100 µg

Rabbit anti-MGRNl Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Human TACSTD2 Protein, His, E.coli-5ug
QP13683-HIS-5ug 5ug

Recombinant Human TACSTD2 Protein, His, E.coli-5ug

Sign In for Pricing
View Details