Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 beta, Mouse (His)

IL-1 beta protein is a potent pro-inflammatory cytokine and major endogenous pyrogen that induces immune cell effects such as prostaglandin synthesis, neutrophil activation, T- and B-cell activation, and fibroblast proliferation . It promotes Th17 differentiation and synergizes with IL12 to promote Th1 IFNG synthesis. Animal-Free IL-1 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 beta Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-beta-protein-mouse-his.html

Purity

95.0

Smiles

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Molecular Formula

16176 (Gene_ID) P10749 (V118-S269) (Accession)

Molecular Weight

Approximately 17-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAMP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43085111 3x 1.0 µg

SCAMP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human MTRNR2L4 shRNA (UAS) - Lentiviral human MTRNR2L4 shRNA (UAS, RFP) (100)
GTR15318843 1 Vial

Lentiviral human MTRNR2L4 shRNA (UAS) - Lentiviral human MTRNR2L4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27) (MaxLight 405) discontinued
137853-ML405 100 µL

CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ETHE1 (NM_014297) Human Tagged Lenti ORF Clone
RC202114L2 10 µg

ETHE1 (NM_014297) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
anti-TBX22
YF-PA26127 50 ul

anti-TBX22

Sign In for Pricing
View Details
Ifi27l2a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3134003 1.0 µg DNA

Ifi27l2a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details