Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial

Product Specifications

Abbreviation

Recombinant Human herpesvirus 2 UL20 protein, partial

Gene Name

UL20

UniProt

P89443

Expression Region

1-63aa

Organism

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Target Sequence

MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP12, NT (NLRP12, NALP12, PYPAF7, RNO, NACHT, LRR and PYD domains-containing protein 12, Monarch-1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide) (MaxLight 405) discontinued
039019-ML405 100 µL

NLRP12, NT (NLRP12, NALP12, PYPAF7, RNO, NACHT, LRR and PYD domains-containing protein 12, Monarch-1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FCN1, CT (FCN1, FCNM, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, Ficolin-A, Ficolin-alpha, M-ficolin) (MaxLight 490) discontinued
035587-ML490 100 µL

FCN1, CT (FCN1, FCNM, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, Ficolin-A, Ficolin-alpha, M-ficolin) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)
MBS1497954-01 0.05 mL

Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)

Sign In for Pricing
View Details
Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)
MBS1497954-02 0.1 mL

Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)

Sign In for Pricing
View Details
Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)
MBS1497954-03 5x 0.1 mL

Rabbit anti-human Arachidonate 15-lipoxygenase B polyclonal Antibody(ALOX15B)

Sign In for Pricing
View Details
TICRR siRNA (Human)
MBS8226730-01 15 nmol

TICRR siRNA (Human)

Sign In for Pricing
View Details