Question 1

What is the catalog number for EIF4B Protein (N-GST&C-His, Human)?

Accepted Answer

The catalog number for EIF4B Protein (N-GST&C-His, Human) is P503561.

Question 2

What sizes are available for EIF4B Protein (N-GST&C-His, Human)?

Accepted Answer

EIF4B Protein (N-GST&C-His, Human) is available in the following size(s): 100 µg.

Question 3

Is EIF4B Protein (N-GST&C-His, Human) in stock?

Accepted Answer

EIF4B Protein (N-GST&C-His, Human) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What should I check when this product first arrives?

Accepted Answer

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Question 5

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Accepted Answer

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

Question 6

What should I do if I need to report a performance issue with a specific lot of this product?

Accepted Answer

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

EIF4B Protein (N-GST&C-His, Human)

Product Specifications

Abbreviation

Synonyms

Host

Tag

Applications

Purity

Function

Molecular Weight

Species

Frequently Asked Questions

Explore Other Products

BCAR1 Protein Vector (Mouse) (pPB-C-His)

Phospho-PRKDC (Ser2056) Antibody Blocking Peptide

MeCP2 Rabbit pAb, PE-Cy5.5 conjugated

H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2

H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2

H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2