Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RI/TNFRSF1A, Human (HEK293, His)

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.

Product Specifications

Product Name Alternative

TNF RI/TNFRSF1A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfr-1-cd120a-protein-human-hek293-his.html

Purity

95.0

Smiles

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Molecular Formula

7132 (Gene_ID) P19438-1 (L30-T211) (Accession)

Molecular Weight

28-38kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal UBE2W Antibody (10) [HRP]
NBP3-05884H 0.1 mL

Mouse Monoclonal UBE2W Antibody (10) [HRP]

Sign In for Pricing
View Details
N- (2-Hydroxypyridin-3-yl) acetamide
456936-01 25 mg

N- (2-Hydroxypyridin-3-yl) acetamide

Sign In for Pricing
View Details
N- (2-Hydroxypyridin-3-yl) acetamide
456936-02 50 mg

N- (2-Hydroxypyridin-3-yl) acetamide

Sign In for Pricing
View Details
COC-BSA2
B10-Ag2 1 g

COC-BSA2

Sign In for Pricing
View Details
Anti-NEBL / nebulette antibody
STJ71951 100 µg

Anti-NEBL / nebulette antibody

Sign In for Pricing
View Details
TCF7L2 (Transcription Factor 7-like 2, HMG Box Transcription Factor 4, T-cell-specific Transcription Factor 4, T-cell Factor 4, TCF-4, hTCF-4, TCF4) (MaxLight 650)
MBS6225037-01 0.1 mL

TCF7L2 (Transcription Factor 7-like 2, HMG Box Transcription Factor 4, T-cell-specific Transcription Factor 4, T-cell Factor 4, TCF-4, hTCF-4, TCF4) (MaxLight 650)

Sign In for Pricing
View Details