Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G, Human (HEK293, His)

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (HEK293, His) is the recombinant human-derived HLA-G protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

HLA-G Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-g-protein-human-hek-293-his.html

Purity

90.00

Smiles

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Molecular Formula

3135 (Gene_ID) P17693-1 (G25-D338) (Accession)

Molecular Weight

Approximately 39.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1310 Rabbit pAb
E47R16997 100 µL

KIAA1310 Rabbit pAb

Sign In for Pricing
View Details
Caspase 9 Blocking Peptide
abx062051-01 1 mg

Caspase 9 Blocking Peptide

Sign In for Pricing
View Details
Caspase 9 Blocking Peptide
abx062051-02 5 mg

Caspase 9 Blocking Peptide

Sign In for Pricing
View Details
Fit 10ml Thermo pipette, clear, sterile, rack pack
PT-10000R-T 24 PCS/Rack - 40 Racks/Case

Fit 10ml Thermo pipette, clear, sterile, rack pack

Sign In for Pricing
View Details
Sacituzumab Biosimilar, Human Trop-2
592177-01 100 µg

Sacituzumab Biosimilar, Human Trop-2

Sign In for Pricing
View Details
Sacituzumab Biosimilar, Human Trop-2
592177-02 1 mg

Sacituzumab Biosimilar, Human Trop-2

Sign In for Pricing
View Details