Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOX3 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to ACOX3

Product Specifications

UniProt

O15254

Reactivity

Human, Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ACOX3

Target

ACOX3

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

Field of Research

Metabolism Research

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

77kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Bromomethyl) oxetane
PMB75923-01 50 mg

2- (Bromomethyl) oxetane

Sign In for Pricing
View Details
2- (Bromomethyl) oxetane
PMB75923-02 0.5 g

2- (Bromomethyl) oxetane

Sign In for Pricing
View Details
CD79a (B Cell Antigen Receptor Complex Associated Protein alpha Chain, B Cell Antigen Receptor Complex Associated Protein alpha Chain Precursor, B Lymphocyte Specific MB1 Protein, B Lymphocyte-specific MB1 Protein, B-cell Antigen Receptor Complex-associated Protein alpha Chain, CD 79a, CD79a Antigen (Immunoglobulin-associated alpha), CD79A Antigen, CD79A Antigen Immunoglobulin Associated alpha, CD79a Molecule Immunoglobulin Associated alpha, CD79a Molecule, Immunoglobulin-associated alpha, CD79A_HUMAN, Ig alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin Associated Alpha, Immunoglobulin-associated alpha, Ly54, MB 1, MB 1 Membrane Glycoprotein, MB-1 Membrane Glycoprotein, MB1, MB1 Membrane Glycoprotein, Membrane Bound Immunoglobulin Associated Protein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM Associated Protein, Cluster of Differentiation CD79A, Surface IgM-associated Protein)
303219 100 µg

CD79a (B Cell Antigen Receptor Complex Associated Protein alpha Chain, B Cell Antigen Receptor Complex Associated Protein alpha Chain Precursor, B Lymphocyte Specific MB1 Protein, B Lymphocyte-specific MB1 Protein, B-cell Antigen Receptor Complex-associated Protein alpha Chain, CD 79a, CD79a Antigen (Immunoglobulin-associated alpha), CD79A Antigen, CD79A Antigen Immunoglobulin Associated alpha, CD79a Molecule Immunoglobulin Associated alpha, CD79a Molecule, Immunoglobulin-associated alpha, CD79A_HUMAN, Ig alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin Associated Alpha, Immunoglobulin-associated alpha, Ly54, MB 1, MB 1 Membrane Glycoprotein, MB-1 Membrane Glycoprotein, MB1, MB1 Membrane Glycoprotein, Membrane Bound Immunoglobulin Associated Protein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM Associated Protein, Cluster of Differentiation CD79A, Surface IgM-associated Protein)

Sign In for Pricing
View Details
BSA (Fatty Acid & IgG Free, BioPremium)
ST025-20g 20 g

BSA (Fatty Acid & IgG Free, BioPremium)

Sign In for Pricing
View Details
Human EFEMP2 Knockout A549 cell line
GTR15415822 1 Vial

Human EFEMP2 Knockout A549 cell line

Sign In for Pricing
View Details
RAB1C Protein Vector (Human) (pPB-C-His)
PV114514 500 ng

RAB1C Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details