Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, His)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, His) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-his.html

Purity

98.00

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-P283) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Polyclonal Human IgA Lambda Isotype Control [DyLight 594]
NBP3-06874DL594 0.1 mL

Human Polyclonal Human IgA Lambda Isotype Control [DyLight 594]

Sign In for Pricing
View Details
Rho A (26C4) HRP
sc-418 HRP 200 µg/mL

Rho A (26C4) HRP

Sign In for Pricing
View Details
Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT
E1680Hu-01 48 Well

Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT

Sign In for Pricing
View Details
Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT
E1680Hu-02 96 Well

Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT

Sign In for Pricing
View Details
Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT
E1680Hu-03 5x 96 Tests

Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT

Sign In for Pricing
View Details
Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT
E1680Hu-04 10x 96 Tests

Human colon cancer-specific antigen-2, CCSA-2 ELISA KIT

Sign In for Pricing
View Details