Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tityus zulianus Beta-toxin Tz1

Product Specifications

Product Name Alternative

PT-beta NaTx14.1

Abbreviation

Recombinant Tityus zulianus Beta-toxin Tz1 protein

UniProt

Q2NME3

Expression Region

21-84aa

Organism

Tityus zulianus (Venezuelan scorpion)

Target Sequence

KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWDRATNRCGR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Strongly affects skeletal muscle channels Nav1.4/SCN4A, poorly affects the neuronal channels Nav1.6/SCN8A and Nav1.2/SCN2A. Induces spastic paralysis of rear limbs, increased salivation, apnea, tachycardia and increased perspiration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.3 kDa

References & Citations

"Diversity of long-chain toxins in Tityus zulianus and Tityus discrepans venoms (Scorpiones, Buthidae) : molecular, immunological, and mass spectral analyses." Borges A., Garcia C.C., Lugo E., Alfonzo M.J., Jowers M.J., Op den Camp H.J.M. Comp. Biochem. Physiol. 142C:240-252 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL
BNC880755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF740 conjugate, 0.1mg/mL
BNC741813-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details