Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1)

Product Specifications

Product Name Alternative

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)

Abbreviation

Recombinant Mouse Echs1 protein

Gene Name

Echs1

UniProt

Q8BH95

Expression Region

28-290aa

Organism

Mus musculus (Mouse)

Target Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLNS1A 3'UTR Luciferase Stable Cell Line
TU004604 1.0 mL

CLNS1A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RUFY4 AAV Vector (Mouse) (CMV)
42882105 1 µg

RUFY4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Influenza A H7N2 (A/ruddy turnstone/New Jersey/563/2006) Hemagglutinin Protein (HA1 Subunit) (His Tag)
MBS8118757-01 0.1 mg

Influenza A H7N2 (A/ruddy turnstone/New Jersey/563/2006) Hemagglutinin Protein (HA1 Subunit) (His Tag)

Sign In for Pricing
View Details
Influenza A H7N2 (A/ruddy turnstone/New Jersey/563/2006) Hemagglutinin Protein (HA1 Subunit) (His Tag)
MBS8118757-02 5x 0.1 mg

Influenza A H7N2 (A/ruddy turnstone/New Jersey/563/2006) Hemagglutinin Protein (HA1 Subunit) (His Tag)

Sign In for Pricing
View Details
Autophagin 4D Antibody / ATG4D
F54718-0.4ML 0.4 mL

Autophagin 4D Antibody / ATG4D

Sign In for Pricing
View Details
Strn4 Mouse Gene Knockout Kit (CRISPR)
KN516916 1 Kit

Strn4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details