Betacellulin, Human
Probetacellulin Protein, Human is a glycoprotein, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.
Product Specifications
Product Name Alternative
Betacellulin Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/probetacellulin-protein-human.html
Purity
95.0
Smiles
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Molecular Formula
685 (Gene_ID) P35070 (D32-Y111) (Accession)
Molecular Weight
Approximately 15 kDa
References & Citations
[1]Yamamoto K, et al. Recombinant human betacellulin promotes the neogenesis of beta-cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 2000 Dec;49 (12) :2021-7.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL517178V 500 µL Each
Nucks1 Mouse shRNA Lentiviral Particle (Locus ID 98415)
Sign In for Pricing
View Details 
MBS6201413-01 0.1 mL
ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (MaxLight 490)
Sign In for Pricing
View Details MBS6201413-02 5x 0.1 mL
ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (MaxLight 490)
Sign In for Pricing
View Details 
E-EL-M0141 96 Tests
ELISA kit for Mouse AIF (Apoptosis Inducing Factor)
Sign In for Pricing
View Details