Question 1

What is the catalog number for Uricase - Customized version 1?

Accepted Answer

The catalog number for Uricase - Customized version 1 is HH0901-01.

Question 2

What sizes are available for Uricase - Customized version 1?

Accepted Answer

Uricase - Customized version 1 is available in the following size(s): 2 KU.

Question 3

Is Uricase - Customized version 1 in stock?

Accepted Answer

Uricase - Customized version 1 is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What is the shelf life of this product?

Accepted Answer

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

Question 5

What expression system was used for this recombinant protein?

Accepted Answer

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Question 6

Can I return this product if I ordered the wrong one?

Accepted Answer

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Uricase - Customized version 1

Product Specifications

Abbreviation

Shipping Conditions

Storage Conditions

Unit

Frequently Asked Questions

Explore Other Products

Gap junction gamma-2 protein (GJC2) Bovine ELISA Kit

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Pramipexole Nitroso Impurity 6

Mmu-miR-452-5p miRNA Antagomir

Mmu-miR-452-5p miRNA Antagomir