Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to GNAI3

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3

Target

GNAI3

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

39kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem53 ORF Vector (Mouse) (pORF)
ORF059940 1.0 µg DNA

Tmem53 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)
MBS6233608-01 0.1 mL

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)
MBS6233608-02 5x 0.1 mL

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137) (MaxLight 750)

Sign In for Pricing
View Details
Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit
MBS9366329-01 48 Well

Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit

Sign In for Pricing
View Details
Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit
MBS9366329-02 96 Well

Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit

Sign In for Pricing
View Details
Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit
MBS9366329-03 5x 96 Well

Hamster Double C2-Like Domain-Containing Protein Beta (DOC2B) ELISA Kit

Sign In for Pricing
View Details