Apolipoprotein M/APOM, Human (166a.a, HEK293, His)
Apolipoprotein M Protein, Human (166a.a, HEK293, His) expresses in HEK293, does not contain signal peptide sequence with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1].
Product Specifications
Product Name Alternative
Apolipoprotein M/APOM Protein, Human (166a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apolipoprotein-m-apom-protein-human-166a-a-hek293-his.html
Purity
97.00
Smiles
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Molecular Formula
55937 (Gene_ID) O95445-1 (C23-N188) (Accession)
Molecular Weight
19-24 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740012-500 1x 500 µL
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881947-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details