Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (166a.a, HEK293, His)

Apolipoprotein M Protein, Human (166a.a, HEK293, His) expresses in HEK293, does not contain signal peptide sequence with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1].

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (166a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-apom-protein-human-166a-a-hek293-his.html

Purity

97.00

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (C23-N188) (Accession)

Molecular Weight

19-24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal beta Amyloid Antibody (MOAB-2) [DyLight 594]
NBP2-13075DL594 0.1 mL

Mouse Monoclonal beta Amyloid Antibody (MOAB-2) [DyLight 594]

Sign In for Pricing
View Details
ACSL3 CRISPR Activation Plasmid (m2)
sc-428791-ACT-2 20 µg

ACSL3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
INPP5A Polyclonal Antibody, Biotin Conjugated
A55254-100 100 µL

INPP5A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Anti-PRSS21 Antibody
MBS8322744-01 0.03 mL

Anti-PRSS21 Antibody

Sign In for Pricing
View Details
Anti-PRSS21 Antibody
MBS8322744-02 0.05 mL

Anti-PRSS21 Antibody

Sign In for Pricing
View Details
Anti-PRSS21 Antibody
MBS8322744-03 0.1 mL

Anti-PRSS21 Antibody

Sign In for Pricing
View Details