Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hordeum vulgare Gamma-hordein-3

Product Specifications

Abbreviation

Recombinant Hordeum vulgare Gamma-hordein-3 protein

UniProt

P80198

Expression Region

1-289aa

Organism

Hordeum vulgare (Barley)

Target Sequence

ITTTTMQFNPSGLELERPQQLFPQWQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQQFPQQMPLQPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIEEQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGHGFVQSQLQQLGQGMPIQLQQQPGQAFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCSPFGSMATGSGGQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Has a role in the transport and targeting of prolamins to the vacuole of developing barley endosperm.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.6 kDa

References & Citations

"A role for gamma 3 hordein in the transport and targeting of prolamin polypeptides to the vacuole of developing barley endosperm." Rechinger K.B., Simpson D.J., Svendsen I., Cameron-Mills V. Plant J. 4:841-853 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD3 epsilon Antibody (C3e/1308) [DyLight 650]
NBP2-54392C 100 µL

Mouse Monoclonal CD3 epsilon Antibody (C3e/1308) [DyLight 650]

Sign In for Pricing
View Details
Lentiviral human TMEM168 sgRNA gene knockout kit - Lentiviral human TMEM168 sgRNA gene knockout kit (plasmid)
GTR15361787 1 Vial

Lentiviral human TMEM168 sgRNA gene knockout kit - Lentiviral human TMEM168 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Col4a4 Mouse siRNA Oligo Duplex (Locus ID 12829)
SR423123 1 Kit

Col4a4 Mouse siRNA Oligo Duplex (Locus ID 12829)

Sign In for Pricing
View Details
Human Leukotriene C4 (LTC4) CLIA Kit
abx197221 96 Tests

Human Leukotriene C4 (LTC4) CLIA Kit

Sign In for Pricing
View Details
MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, EVI1, MDS1, PRDM3, MDS1-EVI1, AML1-EVI-1) (Biotin)
MBS6426421-01 0.1 mL

MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, EVI1, MDS1, PRDM3, MDS1-EVI1, AML1-EVI-1) (Biotin)

Sign In for Pricing
View Details
MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, EVI1, MDS1, PRDM3, MDS1-EVI1, AML1-EVI-1) (Biotin)
MBS6426421-02 5x 0.1 mL

MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, EVI1, MDS1, PRDM3, MDS1-EVI1, AML1-EVI-1) (Biotin)

Sign In for Pricing
View Details